General Information

  • ID:  hor003267
  • Uniprot ID:  Q60478
  • Protein name:  Leumorphin
  • Gene name:  PDYN
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Opioid neuropeptide precursor family
  • Source:  Animal
  • Expression:  brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0005886 plasma membrane; GO:0098686 hippocampal mossy fiber to CA3 synapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  YGGFLRRQFKVVTRSQEDPNAYSEEFFDV
  • Length:  29(217-245)
  • Propeptide:  MVWPRLVLAACLLAMPPAAAECLSQCSLCAVRTQDGPKPINPLICSLECQETLLPSEEWERCQGILSFFPSALRLRDQSGLDSRAALEEVYGELAKRARPFLQELEKSRFLPSTPAEDKFRGLLGGLGEGLGSEAMGAPQLNSGAVEAAALDFDEDPKEQVKRYGGFLRKYPKRSSEVAREGDRDGDNAGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSEEFFDV
  • Signal peptide:  MVWPRLVLAACLLAMPPAAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Leumorphin has a typical opiod activity and may have anti-apoptotic effect.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q60478-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003267_AF2.pdbhor003267_ESM.pdb

Physical Information

Mass: 398540 Formula: C158H230N42O48
Absent amino acids: CHIMW Common amino acids: F
pI: 4.67 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -80.34 Boman Index: -8290
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 46.9
Instability Index: 8759.31 Extinction Coefficient cystines: 2980
Absorbance 280nm: 106.43

Literature

  • PubMed ID:  8985124
  • Title:  Guinea Pig Preprodynorphin mRNA: Primary Structure and Regional Quantitation in the Brain